General Information

  • ID:  hor005213
  • Uniprot ID:  P82015
  • Protein name:  Diuretic hormone 2
  • Gene name:  NA
  • Organism:  Hyles lineata (White-lined sphinx moth)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hyles (genus), Macroglossini (tribe), Macroglossinae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFSVNPAVEILQHRYMEKVAQNNRNFLNRV
  • Length:  30
  • Propeptide:  SFSVNPAVEILQHRYMEKVAQNNRNFLNRV
  • Signal peptide:  NA
  • Modification:  T30 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82015-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P82015-F1.pdbhor005213_AF2.pdbhor005213_ESM.pdb

Physical Information

Mass: 409250 Formula: C157H249N49O45S
Absent amino acids: CDGTW Common amino acids: N
pI: 10.44 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -55.33 Boman Index: -7696
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 84.33
Instability Index: 4724 Extinction Coefficient cystines: 1490
Absorbance 280nm: 51.38

Literature

  • PubMed ID:  10696588
  • Title:  Isolation and characterization of CRF-related diuretic hormones from the whitelined sphinx moth Hyles lineata.